PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G30420.1
Common NameETC2, T6B20, T9D9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 112aa    MW: 13605.4 Da    PI: 10.6484
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G30420.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.85.1e-084079445
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     +T++E++l+ +  ++ G++ W++Ia ++  gR ++++  +w 
      AT2G30420.1 40 MTEQEEDLISRMYRLVGNR-WDLIAGRVV-GRKANEIERYWI 79
                     79*****************.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.6E-53684IPR001005SANT/Myb domain
CDDcd001673.42E-53978No hitNo description
PfamPF002492.7E-74079IPR001005SANT/Myb domain
SuperFamilySSF466891.45E-64188IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-104179IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080147Biological Processroot hair cell development
GO:1900033Biological Processnegative regulation of trichome patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MDNTNRLRLR RGPSLRQTKF TRSRYDSEEV SSIEWEFISM TEQEEDLISR MYRLVGNRWD  60
LIAGRVVGRK ANEIERYWIM RNSDYFSHKR RRLNNSPFFS TSPLNLQENL KL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18892KRRRL
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865042690.0
Genevisible267495_at1e-115
Expression AtlasAT2G30420-
AtGenExpressAT2G30420-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stomatal guard mother cells, young stomata and trichomes of young leaves, and inflorescences. {ECO:0000269|PubMed:15604688}.
Functional Description ? help Back to Top
Source Description
TAIRIn a tandem repeat with AT2G30424 and AT2G30432
UniProtMYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15604688, ECO:0000269|PubMed:19818620}.
Function -- GeneRIF ? help Back to Top
  1. ETC2 is the major locus determining trichome patterning in natural Arabidopsis populations.
    [PMID: 19818620]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G30420.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q84RD1
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G30420
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2344110.0AY234411.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
GenBankAY5195200.0AY519520.1 Arabidopsis thaliana MYB transcription factor (At2g30420) mRNA, complete cds.
GenBankAY6492550.0AY649255.1 Arabidopsis thaliana hypothetical protein (At2g30420) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850145.15e-77protein ENHANCER OF TRY AND CPC 2
SwissprotQ84RD16e-79ETC2_ARATH; MYB-like transcription factor ETC2
TrEMBLD6C5828e-76D6C582_ARATH; Enhancer of triptychon and caprice 2
STRINGAT2G30420.12e-76(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Representative plantOGRP4207823
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Xiao YL,Malik M,Whitelaw CA,Town CD
    Cloning and sequencing of cDNAs for hypothetical genes from chromosome 2 of Arabidopsis.
    Plant Physiol., 2002. 130(4): p. 2118-28
    [PMID:12481096]
  3. Wu XM,Lim SH,Yang WC
    Characterization, expression and phylogenetic study of R2R3-MYB genes in orchid.
    Plant Mol. Biol., 2003. 51(6): p. 959-72
    [PMID:12777054]
  4. Kirik V,Simon M,Huelskamp M,Schiefelbein J
    The ENHANCER OF TRY AND CPC1 gene acts redundantly with TRIPTYCHON and CAPRICE in trichome and root hair cell patterning in Arabidopsis.
    Dev. Biol., 2004. 268(2): p. 506-13
    [PMID:15063185]
  5. Czechowski T,Bari RP,Stitt M,Scheible WR,Udvardi MK
    Real-time RT-PCR profiling of over 1400 Arabidopsis transcription factors: unprecedented sensitivity reveals novel root- and shoot-specific genes.
    Plant J., 2004. 38(2): p. 366-79
    [PMID:15078338]
  6. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  7. Kirik V,Simon M,Wester K,Schiefelbein J,Hulskamp M
    ENHANCER of TRY and CPC 2 (ETC2) reveals redundancy in the region-specific control of trichome development of Arabidopsis.
    Plant Mol. Biol., 2004. 55(3): p. 389-98
    [PMID:15604688]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Schwab R,Ossowski S,Riester M,Warthmann N,Weigel D
    Highly specific gene silencing by artificial microRNAs in Arabidopsis.
    Plant Cell, 2006. 18(5): p. 1121-33
    [PMID:16531494]
  10. Guimil S,Dunand C
    Patterning of Arabidopsis epidermal cells: epigenetic factors regulate the complex epidermal cell fate pathway.
    Trends Plant Sci., 2006. 11(12): p. 601-9
    [PMID:17088095]
  11. Simon M,Lee MM,Lin Y,Gish L,Schiefelbein J
    Distinct and overlapping roles of single-repeat MYB genes in root epidermal patterning.
    Dev. Biol., 2007. 311(2): p. 566-78
    [PMID:17931617]
  12. Dubos C, et al.
    MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana.
    Plant J., 2008. 55(6): p. 940-53
    [PMID:18532978]
  13. Jakoby MJ, et al.
    Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106.
    Plant Physiol., 2008. 148(3): p. 1583-602
    [PMID:18805951]
  14. Wester K, et al.
    Functional diversity of R3 single-repeat genes in trichome development.
    Development, 2009. 136(9): p. 1487-96
    [PMID:19336467]
  15. Hilscher J,Schlötterer C,Hauser MT
    A single amino acid replacement in ETC2 shapes trichome patterning in natural Arabidopsis populations.
    Curr. Biol., 2009. 19(20): p. 1747-51
    [PMID:19818620]
  16. Atwell S, et al.
    Genome-wide association study of 107 phenotypes in Arabidopsis thaliana inbred lines.
    Nature, 2010. 465(7298): p. 627-31
    [PMID:20336072]
  17. Tominaga-Wada R,Nukumizu Y
    Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-Related transcripts in Arabidopsis.
    Int J Mol Sci, 2012. 13(3): p. 3478-91
    [PMID:22489163]
  18. Tominaga-Wada R,Nukumizu Y,Sato S,Wada T
    Control of plant trichome and root-hair development by a tomato (Solanum lycopersicum) R3 MYB transcription factor.
    PLoS ONE, 2013. 8(1): p. e54019
    [PMID:23326563]
  19. Nukumizu Y,Wada T,Tominaga-Wada R
    Tomato (Solanum lycopersicum) homologs of TRIPTYCHON (SlTRY) and GLABRA3 (SlGL3) are involved in anthocyanin accumulation.
    Plant Signal Behav, 2013. 8(7): p. e24575
    [PMID:23603939]